Join Our Mailing List for Monthly Deals Check it Out

Disclaimer

RESEARCH USE ONLY. This product is intended exclusively for in vitro research and laboratory experimentation. By law, it is strictly prohibited for human or animal consumption, Injection, or administration of any kind. Handle with extreme caution.

LL-37 10 mg

$65.00

Product Description

LL-37 is a naturally occurring antimicrobial peptide produced by the human body as part of the innate immune system. Composed of 37 amino acids, it is derived from the cathelicidin protein and plays a key role in defending against bacterial, viral, and fungal infections. LL-37 exhibits broad-spectrum antimicrobial activity by disrupting pathogen cell membranes, while also promoting wound healing and modulating immune responses. In research and therapeutic contexts, synthetic LL-37 is explored for its potential in treating infections, chronic wounds, and inflammatory conditions.

Product Id:

In stock

Category:

LL-37: A Versatile Peptide Powerhouse

LL-37, a 37-amino-acid peptide with the sequence [LL-37, 37 aa], emerges from the human cathelicidin protein hCAP18, produced by cells like white blood cells and epithelial tissues. As a linchpin of the innate immune system, its amphipathic nature—balancing hydrophilic and hydrophobic regions—equips it to tackle pathogens head-on. LL-37 punches through bacterial cell walls, triggering rapid microbial death, and extends its reach to viruses and fungi, establishing itself as a broad-spectrum defender. Studies reveal its lethal impact on Staphylococcus aureus, a notorious player in upper respiratory infections, and its prowess against eye pathogens. It dismantles densely packed bacterial biofilms, as shown in cell studies, and induces programmed cell death (apoptosis) in harmful microorganisms, offering a multi-pronged assault on infection.

But LL-37’s influence stretches far beyond microbial combat. It supercharges immune function by recruiting a host of immune cells—T cells, monocytes, neutrophils, mast cells—to infection sites, while also steering dendritic cell maturation and amplifying the production of cytokines, chemokines, and their receptors. It curbs damage from bacterial products like lipopolysaccharides (LPS), binding and neutralizing them to prevent excessive inflammation. Research highlights its synergy with human beta-defensin 2 (HBD-2) in psoriasis patients to obliterate S. aureus, and its enhancement of lysozyme’s antibacterial effects. In dialysis patients, elevated LL-37 levels correlate with lower infection-related mortality, and studies suggest it could benefit sepsis treatment. Cell research also points to its ability to boost the immunomodulatory power of human placenta-derived mesenchymal stem cells (pMSCs), hinting at broader therapeutic horizons.

Inflammation meets its match with LL-37. By binding to specific receptors and signaling pathways, it dials down pro-inflammatory cytokine release, reins in overzealous immune cell activation, and fosters anti-inflammatory molecule production. This balancing act reduces chronic inflammation and supports tissue healing. Patients with high LL-37 levels post-tonsillectomy show less inflammation, while mouse studies demonstrate its ability to lower inflammatory disease risk and protect collagen in arthritis models. It suppresses NF-kB’s nuclear translocation for an anti-inflammatory boost, slashes cytokine and chemokine levels in human gum cells, and regulates inflammation tied to interleukin-32. In white blood cells, it fine-tunes host defense responses, showcasing its nuanced control.

LL-37 steps into the cancer arena with equal vigor. It disrupts signaling pathways critical for tumor growth, halting proliferation, migration, and invasion in cancers like colon, gastric, skin, ovarian, lung, breast, prostate, and oral, as well as hematologic malignancies. Cell studies reveal it triggers apoptosis in colon cancer, damages DNA in oral cancer cells, and mimics chemotherapeutic effects across human cancer lines. In lung cancer, it cuts pro-inflammatory cytokine production, while in prostate cancer, it curbs invasiveness. In leukemic cells, recombinant LL-37 activates programmed cell death, and in gastric cancer, it stalls proliferation via cell cycle arrest—painting a picture of a potent anti-tumor ally.

Wound healing accelerates under LL-37’s watchful eye. It sparks angiogenesis, forming new blood vessels vital for tissue repair, and rallies keratinocytes and fibroblasts to migrate and proliferate, sealing wounds swiftly. In venous leg ulcer patients, it boosts healing rates nearly six-fold over placebo, with low doses shrinking ulcer areas markedly. Mouse studies confirm enhanced re-epithelialization and granulation tissue formation, bolstered by its antimicrobial and anti-inflammatory properties that keep infections at bay. Cell research underscores its role in driving cell regeneration, making it a cornerstone of recovery.

Heart health benefits from LL-37’s anti-inflammatory and antimicrobial effects, which combat chronic inflammation and infection—key heart disease triggers. It guards against atherosclerosis by limiting arterial plaque buildup and, in mice, inhibits cardiac cell death, suggesting potential in heart failure therapy. Lower LL-37 levels worsen heart failure outcomes, reinforcing its protective role. In the lungs, it mitigates injury by tempering inflammation and clearing pathogens, with mouse studies showing it slows lung disease progression. For bones, LL-37 recruits osteoblasts and growth factors, speeding repair. In rats with bone defects, it spurs new bone formation, while cell studies show it prevents breakdown and draws stem cells to injury sites.

References

Chen, X., Niyonsaba, F., Ushio, H., Okuda, D., Nagaoka, I., Ikeda, S., Okumura, K., & Ogawa, H. (2005). Synergistic effect of antibacterial agents human beta-defensins, cathelicidin LL-37 and lysozyme against Staphylococcus aureus and Escherichia coli. Journal of Dermatological Science, 40(2), 123–132. https://doi.org/10.1016/j.jdermsci.2005.03.014
(Demonstrates antimicrobial synergy with other peptides against key pathogens.)

Chen, X., Zou, X., Qi, G., et al. (2018). Roles and mechanisms of human cathelicidin LL-37 in cancer. Cellular Physiology and Biochemistry, 47(3), 1060–1073. https://doi.org/10.1159/000490168
(Broad review of LL-37’s anti-cancer effects across multiple cancer types, reducing need for redundant cancer studies.)

Choi, K. Y., Napper, S., & Mookherjee, N. (2014). Human cathelicidin LL-37 and its derivative IG-19 regulate interleukin-32-induced inflammation. Immunology, 143(1), 68–80. https://doi.org/10.1111/imm.12291
(Key study on LL-37’s anti-inflammatory role via IL-32 regulation.)

De Yang, Chen, Q., Schmidt, A. P., Anderson, G. M., Wang, J. M., Wooters, J., et al. (2000). LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. Journal of Experimental Medicine, 192(7), 1069–1074. https://doi.org/10.1084/jem.192.7.1069
(Foundational study on LL-37’s immune cell recruitment via FPRL1.)

Dürr, U. H. N., Sudheendra, U. S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta (BBA) – Biomembranes, 1758(9), 1408–1425. https://doi.org/10.1016/j.bbamem.2006.03.030
(Comprehensive overview of LL-37’s structure and antimicrobial mechanism.)

Edfeldt, K., Agerberth, B., Rottenberg, M. E., Gudmundsson, G. H., Wang, X. B., Mandal, K., Xu, Q., & Yan, Z. Q. (2006). Involvement of the antimicrobial peptide LL-37 in human atherosclerosis. Arteriosclerosis, Thrombosis, and Vascular Biology, 26(7), 1551–1557. https://doi.org/10.1161/01.ATV.0000223901.08459.57
(Unique study linking LL-37 to cardiovascular protection.)

Gombart, A. F., Bhan, I., Borregaard, N., et al. (2009). Low plasma level of cathelicidin antimicrobial peptide (hCAP18) predicts increased infectious disease mortality in patients undergoing hemodialysis. Clinical Infectious Diseases, 48(4), 418–424. https://doi.org/10.1086/596314
(Clinical evidence of LL-37’s protective role in infection mortality.)

Grönberg, A., Mahlapuu, M., Ståhle, M., Whately-Smith, C., & Rollman, O. (2014). Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: A randomized, placebo-controlled clinical trial. Wound Repair and Regeneration, 22(5), 613–621. https://doi.org/10.1111/wrr.12215
(Key clinical trial on LL-37’s wound healing efficacy.)

Heilborn, J. D., Nilsson, M. F., Kratz, G., et al. (2003). The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. Journal of Investigative Dermatology, 120(3), 379–389. https://doi.org/10.1046/j.1523-1747.2003.12069.x
(Early study on LL-37’s role in skin wound healing.)

Huang, L. C., Petkova, T. D., Reins, R. Y., Proske, R. J., & McDermott, A. M. (2006). Multifunctional roles of human cathelicidin (LL-37) at the ocular surface. Investigative Ophthalmology & Visual Science, 47(6), 2369–2380. https://doi.org/10.1167/iovs.05-1646
(Specific evidence of LL-37’s antimicrobial activity against eye pathogens.)

Kahlenberg, J. M., & Kaplan, M. J. (2013). Little peptide, big effects: The role of LL-37 in inflammation and autoimmune disease. Journal of Immunology, 191(10), 4895–4901. https://doi.org/10.4049/jimmunol.1302005
(Broad review of LL-37’s role in inflammation and autoimmunity, consolidating related studies.)

Kittaka, M., Shiba, H., Kajiya, M., Fujita, T., Iwata, T., Rathvisal, K., Ouhara, K., Takeda, K., Fujita, T., Komatsuzawa, H., & Kurihara, H. (2013). The antimicrobial peptide LL37 promotes bone regeneration in a rat calvarial bone defect. Peptides, 46, 136–142. https://doi.org/10.1016/j.peptides.2013.06.001
(Distinct study on LL-37’s bone repair capabilities.)

Mookherjee, N., Brown, K. L., Bowdish, D. M. E., Doria, S., Falsafi, R., Hokamp, K., Roche, F. M., Mu, R., Doho, G. H., Pistolic, J., Powers, J. P., Bryan, J., Brinkman, F. S. L., & Hancock, R. E. W. (2006). Modulation of the TLR-mediated inflammatory response by the endogenous human host defense peptide LL-37. Journal of Immunology, 176(4), 2455–2464. https://doi.org/10.4049/jimmunol.176.4.2455
(Key study on LL-37’s modulation of TLR pathways in inflammation.)

Oliveira-Bravo, M., Sangiorgi, B. B., Schiavinato, J. L., et al. (2016). LL-37 boosts immunosuppressive function of placenta-derived mesenchymal stromal cells. Stem Cell Research & Therapy, 7(1), 189. https://doi.org/10.1186/s13287-016-0448-3
(Unique finding on LL-37’s enhancement of MSC immunomodulation.)

Overhage, J., Campisano, A., Bains, M., Torfs, E. C. W., Rehm, B. H. A., & Hancock, R. E. W. (2008). Human host defense peptide LL-37 prevents bacterial biofilm formation. Infection and Immunity, 76(9), 4176–4182. https://doi.org/10.1128/IAI.00318-08
(Critical study on LL-37’s biofilm inhibition.)

Qin, X., Zhu, G., Huang, L., Zhang, W., Huang, Y., & Xi, X. (2019). LL-37 and its analog FF/CAP18 attenuate neutrophil migration in sepsis-induced acute lung injury. Journal of Cellular Biochemistry, 120(4), 4863–4871. https://doi.org/10.1002/jcb.27641
(Specific evidence of LL-37’s lung protection in sepsis.)

Ren, S. X., Cheng, A. S., To, K. F., et al. (2012). Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer. Cancer Research, 72(24), 6512–6523. https://doi.org/10.1158/0008-5472.CAN-12-2359
(Pivotal study on LL-37’s cancer suppression via apoptosis, covering colon cancer.)

Scott, M. G., Davidson, D. J., Gold, M. R., Bowdish, D. M. E., & Hancock, R. E. W. (2002). The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. Journal of Immunology, 169(7), 3883–3891. https://doi.org/10.4049/jimmunol.169.7.3883
(Foundational study on LL-37’s multifunctional immune roles.)

Age Restriction

You must be at least 21 years old to purchase products from Olympic Peptide.